Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (19 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [187142] (19 PDB entries) |
Domain d4qy1q_: 4qy1 Q: [268665] Other proteins in same PDB: d4qy1b_, d4qy1d_, d4qy1f_, d4qy1h_, d4qy1j_, d4qy1l_, d4qy1n_, d4qy1p_, d4qy1r_, d4qy1t_, d4qy1v_, d4qy1x_ automated match to d4cyza_ complexed with nag |
PDB Entry: 4qy1 (more details), 2.59 Å
SCOPe Domain Sequences for d4qy1q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qy1q_ b.19.1.2 (Q:) automated matches {Influenza A virus, different strains [TaxId: 11320]} dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss tqekndlygtqsisisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk yvnrrslmlatgmrnvpe
Timeline for d4qy1q_: