| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (29 species) not a true protein |
| Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries) |
| Domain d4qy1t_: 4qy1 T: [268663] Other proteins in same PDB: d4qy1a_, d4qy1c_, d4qy1e_, d4qy1g_, d4qy1i_, d4qy1k_, d4qy1m_, d4qy1o_, d4qy1q_, d4qy1s_, d4qy1u_, d4qy1w_ automated match to d4d00d_ complexed with nag |
PDB Entry: 4qy1 (more details), 2.59 Å
SCOPe Domain Sequences for d4qy1t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qy1t_ h.3.1.1 (T:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
Timeline for d4qy1t_: