Lineage for d4qy1r_ (4qy1 R:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041677Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3041729Domain d4qy1r_: 4qy1 R: [268661]
    Other proteins in same PDB: d4qy1a_, d4qy1c_, d4qy1e_, d4qy1g_, d4qy1i_, d4qy1k_, d4qy1m_, d4qy1o_, d4qy1q_, d4qy1s_, d4qy1u_, d4qy1w_
    automated match to d4d00d_
    complexed with nag

Details for d4qy1r_

PDB Entry: 4qy1 (more details), 2.59 Å

PDB Description: structure of h10 from human-infecting h10n8 in complex with avian receptor
PDB Compounds: (R:) Hemagglutinin

SCOPe Domain Sequences for d4qy1r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qy1r_ h.3.1.1 (R:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin

SCOPe Domain Coordinates for d4qy1r_:

Click to download the PDB-style file with coordinates for d4qy1r_.
(The format of our PDB-style files is described here.)

Timeline for d4qy1r_: