SCOP 1.75: Domain d1lyb.1: 1lyb A:,B:

Lineage for d1lyb.1 (1lyb A:,B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (3 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Cathepsin D [50665] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50666] (3 PDB entries)

8. Domain d1lyb.1: 1lyb A:,B: [26857]

Details for d1lyb.1

PDB Entry: 1lyb, 2.5 Å

PDB Description: crystal structures of native and inhibited forms of human cathepsin d: implications for lysosomal targeting and drug design

PDB Compounds: (A:) cathepsin d, (B:) cathepsin d

SCOP Domain Sequences for d1lyb.1:

Sequence; same for both SEQRES and ATOM records:

>g1lyb.1 b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) [TaxId: 9606]}
gpipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkyn
sdksstyvkngtsfdihygsgslsgylsqdtvsvpcqXggvkverqvfgeatkqpgitfi
aakfdgilgmayprisvnnvlpvfdnlmqqklvdqnifsfylsrdpdaqpggelmlggtd
skyykgslsylnvtrkaywqvhldqvevasgltlckegceaivdtgtslmvgpvdevrel
qkaigavpliqgeymipcekvstlpaitlklggkgyklspedytlkvsqagktlclsgfm
gmdipppsgplwilgdvfigryytvfdrdnnrvgfaeaa

Timeline for d1lyb.1:

• d1lyb.1 first appeared (with stable ids) in SCOP 1.55
  
• d1lyb.1 appears in SCOP 1.73
  
• d1lyb.1 appears in SCOPe 2.01
  
• d1lyb.1 appears in the current release, SCOPe 2.08