Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189245] (10 PDB entries) |
Domain d4o1xb_: 4o1x B: [268447] automated match to d4eb4a_ complexed with cl, edo, so4; mutant |
PDB Entry: 4o1x (more details), 2.32 Å
SCOPe Domain Sequences for d4o1xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o1xb_ d.117.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} prpphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkg vleellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfg aeyrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppshalcqfcv vnselscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhie plkiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikmem
Timeline for d4o1xb_: