Lineage for d4o1xb_ (4o1x B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972632Species Human (Homo sapiens) [TaxId:9606] [189245] (10 PDB entries)
  8. 2972641Domain d4o1xb_: 4o1x B: [268447]
    automated match to d4eb4a_
    complexed with cl, edo, so4; mutant

Details for d4o1xb_

PDB Entry: 4o1x (more details), 2.32 Å

PDB Description: Crystal structure of human thymidylate synthase double mutant C195S-Y202C
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d4o1xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o1xb_ d.117.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prpphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkg
vleellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfg
aeyrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppshalcqfcv
vnselscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhie
plkiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikmem

SCOPe Domain Coordinates for d4o1xb_:

Click to download the PDB-style file with coordinates for d4o1xb_.
(The format of our PDB-style files is described here.)

Timeline for d4o1xb_: