Lineage for d4eb4a_ (4eb4 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. Protein automated matches [190469] (17 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)
  8. Domain d4eb4a_: 4eb4 A: [220395]
    automated match to d3ed7a_
    complexed with d16, dtt, gol, mes, so4, ump

Details for d4eb4a_

PDB Entry: 4eb4 (more details), 1.7400000000000002 Å

PDB Description: crystal structure of mouse thymidylate synthase in ternary complex with dump and tomudex
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4eb4a_:

Sequence, based on SEQRES records: (download)

>d4eb4a_ d.117.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mlvvgselqsdaqqlsaeaprhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqarys
lrdefpllttkrvfwkgvleellwfikgstnakelsskgvriwdangsrdfldslgfsar
qegdlgpvygfqwrhfgaeykdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkd
lplmalppchalcqfyvvngelscqlyqrsgdmglgvpfniasyalltymiahitglqpg
dfvhtlgdahiylnhieplkiqlqreprpfpklkilrkvetiddfkvedfqiegynphpt
ikmemav

Sequence, based on observed residues (ATOM records): (download)

>d4eb4a_ d.117.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mlvvgselqsdaqrhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpl
lttkrvfwkgvleellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgp
vygfqwrhfgaeykdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalp
pchalcqfyvvngelscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlg
dahiylnhieplkiqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav

SCOPe Domain Coordinates for d4eb4a_ are not available.

Timeline for d4eb4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4eb4b_, d4eb4c_, d4eb4d_