Lineage for d4o1xc_ (4o1x C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972632Species Human (Homo sapiens) [TaxId:9606] [189245] (10 PDB entries)
  8. 2972642Domain d4o1xc_: 4o1x C: [268446]
    automated match to d4eb4a_
    complexed with cl, edo, so4; mutant

Details for d4o1xc_

PDB Entry: 4o1x (more details), 2.32 Å

PDB Description: Crystal structure of human thymidylate synthase double mutant C195S-Y202C
PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d4o1xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o1xc_ d.117.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppshalcqfcvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikmem

SCOPe Domain Coordinates for d4o1xc_:

Click to download the PDB-style file with coordinates for d4o1xc_.
(The format of our PDB-style files is described here.)

Timeline for d4o1xc_: