Lineage for d1fq7a_ (1fq7 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2410318Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2410319Protein Acid protease [50649] (9 species)
  7. 2410320Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (12 PDB entries)
    synonym: saccharopepsin
  8. 2410333Domain d1fq7a_: 1fq7 A: [26835]
    complexed with 2y3, bma, kbg, nag

Details for d1fq7a_

PDB Entry: 1fq7 (more details), 2.8 Å

PDB Description: x-ray structure of inhibitor cp-72,647 bound to saccharopepsin
PDB Compounds: (A:) saccharopepsin

SCOPe Domain Sequences for d1fq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq7a_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydignnavglakai

SCOPe Domain Coordinates for d1fq7a_:

Click to download the PDB-style file with coordinates for d1fq7a_.
(The format of our PDB-style files is described here.)

Timeline for d1fq7a_: