Lineage for d1fq7a_ (1fq7 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) Protein Acid protease [50649] (5 species) 
Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (8 PDB entries) 
Domain d1fq7a_: 1fq7 A: [26835]
Details for d1fq7a_
PDB Entry: 1fq7 (more details), 2.8 Å
PDB Description: x-ray structure of inhibitor cp-72,647 bound to saccharopepsin
SCOP Domain Sequences for d1fq7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fq7a_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydignnavglakai
SCOP Domain Coordinates for d1fq7a_:
Click to download the PDB-style file with coordinates for d1fq7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fq7a_:
- d1fq7a_ appears in SCOP 1.57
- d1fq7a_ appears in the current release, SCOPe 2.08
View in 3D