![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein EIAV protease [50644] (1 species) |
![]() | Species Equine infectious anemia virus [TaxId:11665] [50645] (2 PDB entries) |
![]() | Domain d2fmba_: 2fmb A: [26778] complexed with lp1 |
PDB Entry: 2fmb (more details), 1.8 Å
SCOPe Domain Sequences for d2fmba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} vtynlekrpttivlindtplnvlldtgadtsvlttahynrlkyrgrkyqgtgiggvggnv etfstpvtikkkgrhiktrmlvadipvtilgrdilqdlgaklvl
Timeline for d2fmba_: