Lineage for d2fmb__ (2fmb -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins) 
Protein EIAV protease [50644] (1 species) Species Equine infectious anemia virus [TaxId:11665] [50645] (2 PDB entries) 
Domain d2fmb__: 2fmb - [26778]
Details for d2fmb__
PDB Entry: 2fmb (more details), 1.8 Å
PDB Description: eiav protease complexed with an inhibitor lp-130
SCOP Domain Sequences for d2fmb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fmb__ b.50.1.1 (-) EIAV protease {Equine infectious anemia virus}
vtynlekrpttivlindtplnvlldtgadtsvlttahynrlkyrgrkyqgtgiggvggnv
etfstpvtikkkgrhiktrmlvadipvtilgrdilqdlgaklvl
SCOP Domain Coordinates for d2fmb__:
Click to download the PDB-style file with coordinates for d2fmb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fmb__:
- d2fmb__ appears in SCOP 1.57
- d2fmb__ appears in the current release, SCOPe 2.08, called d2fmba_
View in 3D