PDB entry 2fmb

View 2fmb on RCSB PDB site
Description: eiav protease complexed with an inhibitor lp-130
Class: aspartic protease
Keywords: aspartic protease, retropepsin, retrovirus, eiav, horse
Deposited on 1998-07-13, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: equine infectious anemia virus protease
  Species: Equine infectious anemia virus [TaxId:11665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32542 (0-103)
    • engineered (53)
  Domains in SCOPe 2.08: d2fmba_
• Heterogens: LP1, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fmbA (A:)
  vtynlekrpttivlindtplnvlldtgadtsvlttahynrlkyrgrkyqgtgiggvggnv
  etfstpvtikkkgrhiktrmlvadipvtilgrdilqdlgaklvl