Lineage for d4pj6a3 (4pj6 A:616-706)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376781Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2376803Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2376804Protein automated matches [254707] (4 species)
    not a true protein
  7. 2376805Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries)
  8. 2376827Domain d4pj6a3: 4pj6 A:616-706 [267176]
    Other proteins in same PDB: d4pj6a1, d4pj6a2, d4pj6a4, d4pj6b1, d4pj6b2, d4pj6b4
    automated match to d4p8qa3
    complexed with lys, nag, zn

Details for d4pj6a3

PDB Entry: 4pj6 (more details), 2.96 Å

PDB Description: crystal structure of human insulin regulated aminopeptidase with lysine in active site
PDB Compounds: (A:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4pj6a3:

Sequence, based on SEQRES records: (download)

>d4pj6a3 b.1.30.0 (A:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld
kksgvinlteevlwvkvninmngyyivhyad

Sequence, based on observed residues (ATOM records): (download)

>d4pj6a3 b.1.30.0 (A:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnmsdtsylwhiplsyvtegrnyskyqsvslldkksgvi
nlteevlwvkvninmngyyivhyad

SCOPe Domain Coordinates for d4pj6a3:

Click to download the PDB-style file with coordinates for d4pj6a3.
(The format of our PDB-style files is described here.)

Timeline for d4pj6a3: