Lineage for d4pj6a1 (4pj6 A:159-366)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2429865Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2429866Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2429953Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2429954Protein automated matches [254706] (5 species)
    not a true protein
  7. 2429958Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2429987Domain d4pj6a1: 4pj6 A:159-366 [267174]
    Other proteins in same PDB: d4pj6a2, d4pj6a3, d4pj6a4, d4pj6b2, d4pj6b3, d4pj6b4
    automated match to d4p8qa1
    complexed with lys, nag, zn

Details for d4pj6a1

PDB Entry: 4pj6 (more details), 2.96 Å

PDB Description: crystal structure of human insulin regulated aminopeptidase with lysine in active site
PDB Compounds: (A:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4pj6a1:

Sequence, based on SEQRES records: (download)

>d4pj6a1 b.98.1.0 (A:159-366) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisr
vtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfs
ytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvv
lddglvqdefsesvkmstylvafivgem

Sequence, based on observed residues (ATOM records): (download)

>d4pj6a1 b.98.1.0 (A:159-366) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisr
vtfmsvssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfsy
tdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvvl
ddglvqdefsesvkmstylvafivgem

SCOPe Domain Coordinates for d4pj6a1:

Click to download the PDB-style file with coordinates for d4pj6a1.
(The format of our PDB-style files is described here.)

Timeline for d4pj6a1: