SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4pj6a3 (4pj6 A:616-706)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2033616Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2033638Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2033639Protein automated matches [254707] (4 species)
    not a true protein
  7. 2033640Species Human (Homo sapiens) [TaxId:9606] [255965] (15 PDB entries)
  8. 2033653Domain d4pj6a3: 4pj6 A:616-706 [267176]
    Other proteins in same PDB: d4pj6a1, d4pj6a2, d4pj6a4, d4pj6b1, d4pj6b2, d4pj6b4
    automated match to d4p8qa3
    complexed with lys, nag, zn

Details for d4pj6a3

PDB Entry: 4pj6 (more details), 2.96 Å

PDB Description: Crystal Structure of Human Insulin Regulated Aminopeptidase with Lysine in Active Site
PDB Compounds: (A:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4pj6a3:

Sequence, based on SEQRES records: (download)

>d4pj6a3 b.1.30.0 (A:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld
kksgvinlteevlwvkvninmngyyivhyad

Sequence, based on observed residues (ATOM records): (download)

>d4pj6a3 b.1.30.0 (A:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnmsdtsylwhiplsyvtegrnyskyqsvslldkksgvi
nlteevlwvkvninmngyyivhyad

SCOPe Domain Coordinates for d4pj6a3:

Click to download the PDB-style file with coordinates for d4pj6a3.
(The format of our PDB-style files is described here.)

Timeline for d4pj6a3: