SCOPe 2.08: Domain d4fu4b1: 4fu4 B:104-275

Lineage for d4fu4b1 (4fu4 B:104-275)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Collagenase-3 (MMP-13) [55540] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55541] (47 PDB entries)

8. Domain d4fu4b1: 4fu4 B:104-275 [266269]
   Other proteins in same PDB: d4fu4a2, d4fu4b2
   automated match to d3ba0a1
   complexed with ca, cl, edo, zn

Details for d4fu4b1

PDB Entry: 4fu4, 2.85 Å

PDB Description: Human collagenase 3 (MMP-13) with peptide from pro-domain

PDB Compounds: (B:) collagenase 3

SCOPe Domain Sequences for d4fu4b1:

Sequence; same for both SEQRES and ATOM records:

>d4fu4b1 d.92.1.11 (B:104-275) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]}
ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi
misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha
fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnp

Timeline for d4fu4b1:

• d4fu4b1 first appeared in SCOPe 2.05
  
• d4fu4b1 appears in SCOPe 2.07