Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Collagenase-3 (MMP-13) [55540] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55541] (40 PDB entries) |
Domain d4fu4b1: 4fu4 B:104-275 [266269] Other proteins in same PDB: d4fu4a2, d4fu4b2 automated match to d3ba0a1 complexed with ca, cl, edo, zn |
PDB Entry: 4fu4 (more details), 2.85 Å
SCOPe Domain Sequences for d4fu4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fu4b1 d.92.1.11 (B:104-275) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnp
Timeline for d4fu4b1: