Lineage for d4fu4b1 (4fu4 B:104-275)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917931Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1917932Protein Collagenase-3 (MMP-13) [55540] (2 species)
  7. 1917933Species Human (Homo sapiens) [TaxId:9606] [55541] (40 PDB entries)
  8. 1918023Domain d4fu4b1: 4fu4 B:104-275 [266269]
    Other proteins in same PDB: d4fu4a2, d4fu4b2
    automated match to d3ba0a1
    complexed with ca, cl, edo, zn

Details for d4fu4b1

PDB Entry: 4fu4 (more details), 2.85 Å

PDB Description: Human collagenase 3 (MMP-13) with peptide from pro-domain
PDB Compounds: (B:) collagenase 3

SCOPe Domain Sequences for d4fu4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fu4b1 d.92.1.11 (B:104-275) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]}
ynvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi
misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaaha
fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgdedpnp

SCOPe Domain Coordinates for d4fu4b1:

Click to download the PDB-style file with coordinates for d4fu4b1.
(The format of our PDB-style files is described here.)

Timeline for d4fu4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fu4b2