Lineage for d1bv9a_ (1bv9 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. 15820Domain d1bv9a_: 1bv9 A: [26615]

Details for d1bv9a_

PDB Entry: 1bv9 (more details), 2 Å

PDB Description: hiv-1 protease (i84v) complexed with xv638 of dupont pharmaceuticals

SCOP Domain Sequences for d1bv9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bv9a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlltqigctlnf

SCOP Domain Coordinates for d1bv9a_:

Click to download the PDB-style file with coordinates for d1bv9a_.
(The format of our PDB-style files is described here.)

Timeline for d1bv9a_: