SCOPe 2.08: Domain d4bs6a_: 4bs6 A:

Lineage for d4bs6a_ (4bs6 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [229208] (7 PDB entries)

8. Domain d4bs6a_: 4bs6 A: [265955]
   automated match to d4bs5a_
   complexed with gol, jg7

Details for d4bs6a_

PDB Entry: 4bs6, 1.2 Å

PDB Description: mouse cathepsin s with covalent ligand

PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d4bs6a_:

Sequence; same for both SEQRES and ATOM records:

>d4bs6a_ d.3.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tlpdtvdwrekgcvtevkyqgscgacwafsavgalegqlklktgklislsaqnlvdcsne
ekygnkgcgggymteafqyiidnggieadasypykamdekchynsknraatcsryiqlpf
gdedalkeavatkgpvsvgidashssfffyksgvyddpsctgnvnhgvlvvgygtldgkd
ywlvknswglnfgdqgyirmarnnknhcgiasycsypei

Timeline for d4bs6a_:

• d4bs6a_ first appeared in SCOPe 2.05
  
• d4bs6a_ appears in SCOPe 2.07