SCOPe 2.07: Domain d3p5tm_: 3p5t M:

Lineage for d3p5tm_ (3p5t M:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)

8. Domain d3p5tm_: 3p5t M: [265146]
   automated match to d4c7qa_
   protein/RNA complex

Details for d3p5tm_

PDB Entry: 3p5t, 2.7 Å

PDB Description: CFIm25-CFIm68 complex

PDB Compounds: (M:) Cleavage and polyadenylation specificity factor subunit 6

SCOPe Domain Sequences for d3p5tm_:

Sequence; same for both SEQRES and ATOM records:

>d3p5tm_ d.58.7.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskkl
mdllpkrelhgqnpvvtpsnk

Timeline for d3p5tm_:

• d3p5tm_ first appeared in SCOPe 2.05
  
• d3p5tm_ appears in SCOPe 2.06
  
• d3p5tm_ appears in the current release, SCOPe 2.08