Lineage for d3p5tm_ (3p5t M:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908987Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1908988Protein automated matches [190896] (9 species)
    not a true protein
  7. 1909006Species Human (Homo sapiens) [TaxId:9606] [188315] (74 PDB entries)
  8. 1909045Domain d3p5tm_: 3p5t M: [265146]
    automated match to d4c7qa_
    protein/RNA complex

Details for d3p5tm_

PDB Entry: 3p5t (more details), 2.7 Å

PDB Description: CFIm25-CFIm68 complex
PDB Compounds: (M:) Cleavage and polyadenylation specificity factor subunit 6

SCOPe Domain Sequences for d3p5tm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p5tm_ d.58.7.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskkl
mdllpkrelhgqnpvvtpsnk

SCOPe Domain Coordinates for d3p5tm_:

Click to download the PDB-style file with coordinates for d3p5tm_.
(The format of our PDB-style files is described here.)

Timeline for d3p5tm_: