SCOP 1.63: Domain d1skyb2: 1sky B:21-95

Lineage for d1skyb2 (1sky B:21-95)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

7. Species Bacillus sp., strain ps3 [TaxId:1409] [50620] (1 PDB entry)

8. Domain d1skyb2: 1sky B:21-95 [26478]
   Other proteins in same PDB: d1skyb1, d1skyb3, d1skye1, d1skye3

Details for d1skyb2

PDB Entry: 1sky

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3

SCOP Domain Sequences for d1skyb2:

Sequence; same for both SEQRES and ATOM records:

>d1skyb2 b.49.1.1 (B:21-95) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Bacillus sp., strain ps3}
sqiqvsdvgtviqvgdgiarahgldnvmsgeavefanavmgmalnleennvgivilgpyt
gikegdevrrtgrim

Timeline for d1skyb2:

• d1skyb2 first appeared (with stable ids) in SCOP 1.55
  
• d1skyb2 appears in SCOP 1.61
  
• d1skyb2 appears in SCOP 1.65
  
• d1skyb2 appears in the current release, SCOPe 2.08