Lineage for d1nbmc2 (1nbm C:19-94)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377221Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 377222Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 377223Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 377224Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 377227Species Cow (Bos taurus) [TaxId:9913] [88673] (10 PDB entries)
  8. 377242Domain d1nbmc2: 1nbm C:19-94 [26454]
    Other proteins in same PDB: d1nbma1, d1nbma3, d1nbmb1, d1nbmb3, d1nbmc1, d1nbmc3, d1nbmd1, d1nbmd2, d1nbmd3, d1nbme1, d1nbme2, d1nbme3, d1nbmf1, d1nbmf2, d1nbmf3, d1nbmg_
    complexed with adp, atp, mg, po4, tyn

Details for d1nbmc2

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

SCOP Domain Sequences for d1nbmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbmc2 b.49.1.1 (C:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

SCOP Domain Coordinates for d1nbmc2:

Click to download the PDB-style file with coordinates for d1nbmc2.
(The format of our PDB-style files is described here.)

Timeline for d1nbmc2: