Class a: All alpha proteins [46456] (202 folds) |
Fold a.69: Left-handed superhelix [47916] (3 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88893] (10 PDB entries) |
Domain d1nbmc1: 1nbm C:380-510 [18289] Other proteins in same PDB: d1nbma2, d1nbma3, d1nbmb2, d1nbmb3, d1nbmc2, d1nbmc3, d1nbmd1, d1nbmd2, d1nbmd3, d1nbme1, d1nbme2, d1nbme3, d1nbmf1, d1nbmf2, d1nbmf3, d1nbmg_ complexed with adp, atp, mg, po4, tyn |
PDB Entry: 1nbm (more details), 3 Å
SCOP Domain Sequences for d1nbmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbmc1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d1nbmc1: