Lineage for d1nbmc3 (1nbm C:95-379)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394452Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (12 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 394505Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 394508Species Cow (Bos taurus) [TaxId:9913] [88775] (10 PDB entries)
  8. 394523Domain d1nbmc3: 1nbm C:95-379 [32334]
    Other proteins in same PDB: d1nbma1, d1nbma2, d1nbmb1, d1nbmb2, d1nbmc1, d1nbmc2, d1nbmd1, d1nbmd2, d1nbmd3, d1nbme1, d1nbme2, d1nbme3, d1nbmf1, d1nbmf2, d1nbmf3, d1nbmg_
    complexed with adp, atp, mg, po4, tyn

Details for d1nbmc3

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

SCOP Domain Sequences for d1nbmc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbmc3 c.37.1.11 (C:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus)}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d1nbmc3:

Click to download the PDB-style file with coordinates for d1nbmc3.
(The format of our PDB-style files is described here.)

Timeline for d1nbmc3: