Class a: All alpha proteins [46456] (289 folds) |
Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) |
Family a.21.1.0: automated matches [191668] (1 protein) not a true family |
Protein automated matches [191268] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189843] (5 PDB entries) |
Domain d2ctoa1: 2cto A:8-87 [264244] Other proteins in same PDB: d2ctoa2, d2ctoa3 automated match to d1wz6a_ |
PDB Entry: 2cto (more details)
SCOPe Domain Sequences for d2ctoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ctoa1 a.21.1.0 (A:8-87) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpnrkasrnayyffvqekipelrrrglpvarvadaipycssdwallreeekekyaemare wraaqgkdpgpsekqkpvft
Timeline for d2ctoa1: