SCOPe 2.05: Domain d2ctoa_: 2cto A:

Lineage for d2ctoa_ (2cto A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.0: automated matches [191668] (1 protein)
   not a true family

6. Protein automated matches [191268] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189843] (5 PDB entries)

8. Domain d2ctoa_: 2cto A: [264244]
   automated match to d1wz6a_

Details for d2ctoa_

PDB Entry: 2cto

PDB Description: solution structure of the hmg box like domain from human hypothetical protein flj14904

PDB Compounds: (A:) novel protein

SCOPe Domain Sequences for d2ctoa_:

Sequence; same for both SEQRES and ATOM records:

>d2ctoa_ a.21.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmpnrkasrnayyffvqekipelrrrglpvarvadaipycssdwallreeekek
yaemarewraaqgkdpgpsekqkpvftsgpssg

Timeline for d2ctoa_:

• d2ctoa_ is new in SCOPe 2.05-stable
  
• d2ctoa_ is called d2ctoa1 in SCOPe 2.06
  
• d2ctoa_ appears in the current release, SCOPe 2.08, called d2ctoa1