SCOPe 2.08: Domain d2ctoa1: 2cto A:8-87

Lineage for d2ctoa1 (2cto A:8-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.0: automated matches [191668] (1 protein)
   not a true family

6. Protein automated matches [191268] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189843] (8 PDB entries)

8. Domain d2ctoa1: 2cto A:8-87 [264244]
   Other proteins in same PDB: d2ctoa2, d2ctoa3
   automated match to d1wz6a_

Details for d2ctoa1

PDB Entry: 2cto

PDB Description: solution structure of the hmg box like domain from human hypothetical protein flj14904

PDB Compounds: (A:) novel protein

SCOPe Domain Sequences for d2ctoa1:

Sequence; same for both SEQRES and ATOM records:

>d2ctoa1 a.21.1.0 (A:8-87) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpnrkasrnayyffvqekipelrrrglpvarvadaipycssdwallreeekekyaemare
wraaqgkdpgpsekqkpvft

Timeline for d2ctoa1:

• d2ctoa1 first appeared in SCOPe 2.05, called d2ctoa_
  
• d2ctoa1 appears in SCOPe 2.07