| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.3: delta-Endotoxin, C-terminal domain [49796] (1 protein) automatically mapped to Pfam PF03944 |
| Protein delta-Endotoxin, C-terminal domain [49797] (5 species) |
| Species Bacillus thuringiensis, Cry4Ba [TaxId:1428] [267713] (1 PDB entry) |
| Domain d1w99a3: 1w99 A:472-641 [264197] Other proteins in same PDB: d1w99a1, d1w99a2 complexed with br, p6g |
PDB Entry: 1w99 (more details), 1.75 Å
SCOPe Domain Sequences for d1w99a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w99a3 b.18.1.3 (A:472-641) delta-Endotoxin, C-terminal domain {Bacillus thuringiensis, Cry4Ba [TaxId: 1428]}
nnqiytdaitqvpavksnflnatakvikgpghtggdlvaltsngtlsgrmeiqcktsifn
dptrsyglriryaanspivlnvsyvlqgvsrgttistestfsrpnniiptdlkyeefryk
dpfdaivpmrlssnqlitiaiqplnmtsnnqviidrieiipitqsvldet
Timeline for d1w99a3: