Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) automatically mapped to Pfam PF03945 |
Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins) seven-helical bundle with central helix surrounded by six others |
Protein delta-Endotoxin (insectocide), N-terminal domain [56851] (5 species) |
Species Bacillus thuringiensis, Cry4Ba [TaxId:1428] [267711] (1 PDB entry) |
Domain d1w99a1: 1w99 A:84-276 [264195] Other proteins in same PDB: d1w99a2, d1w99a3 complexed with br, p6g |
PDB Entry: 1w99 (more details), 1.75 Å
SCOPe Domain Sequences for d1w99a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w99a1 f.1.3.1 (A:84-276) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, Cry4Ba [TaxId: 1428]} tpervwndfmtntgnlidqtvtayvrtdanakmtvvkdyldqyttkfntwkrepnnqsyr tavitqfnltsaklretavyfsnlvgyellllpiyaqvanfnlllirdglinaqewslar sagdqlyntmvqytkeyiahsitwynkgldvlrnksngqwitfndykremtiqvldilal fasydprrypadk
Timeline for d1w99a1: