PDB entry 1w99

View 1w99 on RCSB PDB site
Description: mosquito-larvicidal toxin cry4ba from bacillus thuringiensis ssp. israelensis
Class: toxin
Keywords: membrane pore, bio-insecticide, dipteran specificity, conformational change, hydrophobic patch, toxin
Deposited on 2004-10-07, released 2005-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.205
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pesticidial crystal protein cry4ba
    Species: BACILLUS THURINGIENSIS SEROVAR ISRAELENSIS [TaxId:1430]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w99a1, d1w99a2, d1w99a3
  • Heterogens: BR, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w99A (A:)
    tpervwndfmtntgnlidqtvtayvrtdanakmtvvkdyldqyttkfntwkrepnnqsyr
    tavitqfnltsaklretavyfsnlvgyellllpiyaqvanfnlllirdglinaqewslar
    sagdqlyntmvqytkeyiahsitwynkgldvlrnksngqwitfndykremtiqvldilal
    fasydprrypadkidntklskteftreiytalvespssksiaaleaaltrdvhlftwlkr
    vdfwtntiyqdlrflsankigfsytnssamqesgiygssgfgsnlthqiqlnsnvyktsi
    tdtsspsnrvtkmdfykidgtlasynsnitptpeglrttffgfstnentpnqptvndyth
    ilsyiktdvidynsnrvsfawthkivdpnnqiytdaitqvpavksnflnatakvikgpgh
    tggdlvaltsngtlsgrmeiqcktsifndptrsyglriryaanspivlnvsyvlqgvsrg
    ttistestfsrpnniiptdlkyeefrykdpfdaivpmrlssnqlitiaiqplnmtsnnqv
    iidrieiipitqsvldet