SCOPe 2.06: Domain d4upec_: 4upe C:

Lineage for d4upec_ (4upe C:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (7 species)
   not a true protein

7. Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)

8. Domain d4upec_: 4upe C: [263988]
   Other proteins in same PDB: d4upeq_, d4uper_, d4upes_
   automated match to d1ubks_
   complexed with ca, f3s, fco, gol, mes, ni, po4, sf4; mutant

Details for d4upec_

PDB Entry: 4upe, 1.8 Å

PDB Description: structure of the unready ni-a state of the s499c mutant of d. fructosovorans nife-hydrogenase

PDB Compounds: (C:) nife-hydrogenase small subunit

SCOPe Domain Sequences for d4upec_:

Sequence; same for both SEQRES and ATOM records:

>d4upec_ e.19.1.1 (C:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
khrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhqa
legkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqka
kpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygelv
hdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqagh
pclgcsepdfwdtmtpfyeqg

Timeline for d4upec_:

• d4upec_ first appeared in SCOPe 2.05
  
• d4upec_ appears in SCOPe 2.07
  
• d4upec_ appears in the current release, SCOPe 2.08