Lineage for d4upec_ (4upe C:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953691Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1953692Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1953693Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 1953723Protein automated matches [190110] (7 species)
    not a true protein
  7. 1953760Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)
  8. 1953775Domain d4upec_: 4upe C: [263988]
    Other proteins in same PDB: d4upeq_, d4uper_, d4upes_
    automated match to d1ubks_
    complexed with ca, f3s, fco, gol, mes, ni, po4, sf4; mutant

Details for d4upec_

PDB Entry: 4upe (more details), 1.8 Å

PDB Description: structure of the unready ni-a state of the s499c mutant of d. fructosovorans nife-hydrogenase
PDB Compounds: (C:) nife-hydrogenase small subunit

SCOPe Domain Sequences for d4upec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4upec_ e.19.1.1 (C:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
khrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhqa
legkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqka
kpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygelv
hdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqagh
pclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d4upec_:

Click to download the PDB-style file with coordinates for d4upec_.
(The format of our PDB-style files is described here.)

Timeline for d4upec_: