Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (21 species) not a true protein |
Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258560] (6 PDB entries) |
Domain d4uo5e_: 4uo5 E: [263986] Other proteins in same PDB: d4uo5b1, d4uo5b2, d4uo5d1, d4uo5d2, d4uo5f1, d4uo5f2 automated match to d4unzc_ complexed with nag, so4 |
PDB Entry: 4uo5 (more details), 2.7 Å
SCOPe Domain Sequences for d4uo5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo5e_ b.19.1.2 (E:) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]} nntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildgrnctli damlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveftaegftw tgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgihhpss nqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins ngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvtygkcpk yirqntlklatgmrnvpek
Timeline for d4uo5e_: