Lineage for d4uo5b1 (4uo5 B:1-172)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646396Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258563] (5 PDB entries)
  8. 2646397Domain d4uo5b1: 4uo5 B:1-172 [258564]
    Other proteins in same PDB: d4uo5a_, d4uo5b2, d4uo5c_, d4uo5d2, d4uo5e_, d4uo5f2
    automated match to d4n5zb_
    complexed with nag, so4

Details for d4uo5b1

PDB Entry: 4uo5 (more details), 2.7 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin in complex with 3sln
PDB Compounds: (B:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4uo5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uo5b1 h.3.1.0 (B:1-172) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4uo5b1:

Click to download the PDB-style file with coordinates for d4uo5b1.
(The format of our PDB-style files is described here.)

Timeline for d4uo5b1: