| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (42 species) not a true protein |
| Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258563] (5 PDB entries) |
| Domain d4uo5b1: 4uo5 B:1-172 [258564] Other proteins in same PDB: d4uo5a_, d4uo5b2, d4uo5c_, d4uo5d2, d4uo5e_, d4uo5f2 automated match to d4n5zb_ complexed with nag, so4 |
PDB Entry: 4uo5 (more details), 2.7 Å
SCOPe Domain Sequences for d4uo5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo5b1 h.3.1.0 (B:1-172) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfq
Timeline for d4uo5b1: