SCOPe 2.05: Domain d4uo5e_: 4uo5 E:

Lineage for d4uo5e_ (4uo5 E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus [TaxId:867285] [258560] (1 PDB entry)

8. Domain d4uo5e_: 4uo5 E: [263986]
   Other proteins in same PDB: d4uo5b_, d4uo5d_, d4uo5f_
   automated match to d4unzc_
   complexed with nag, so4

Details for d4uo5e_

PDB Entry: 4uo5, 2.7 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin in complex with 3sln

PDB Compounds: (E:) h3 haemagglutinin ha1 chain

SCOPe Domain Sequences for d4uo5e_:

Sequence; same for both SEQRES and ATOM records:

>d4uo5e_ b.19.1.2 (E:) automated matches {Influenza a virus [TaxId: 867285]}
nntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildgrnctli
damlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveftaegftw
tgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgihhpss
nqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvtygkcpk
yirqntlklatgmrnvpek

Timeline for d4uo5e_:

• d4uo5e_ is new in SCOPe 2.05-stable
  
• d4uo5e_ appears in SCOPe 2.06
  
• d4uo5e_ appears in the current release, SCOPe 2.08