Lineage for d1qrzd_ (1qrz D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15141Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 15142Species Human (Homo sapiens) [TaxId:9606] [50589] (4 PDB entries)
  8. 15150Domain d1qrzd_: 1qrz D: [26369]

Details for d1qrzd_

PDB Entry: 1qrz (more details), 2 Å

PDB Description: catalytic domain of plasminogen

SCOP Domain Sequences for d1qrzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrzd_ b.47.1.2 (D:) Plasmin(ogen), catalytic domain {Human (Homo sapiens)}
fdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgqhfcggtlispewvltaahcl
eksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipa
clpspnymvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqstel
caghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwie
gvlrnn

SCOP Domain Coordinates for d1qrzd_:

Click to download the PDB-style file with coordinates for d1qrzd_.
(The format of our PDB-style files is described here.)

Timeline for d1qrzd_: