Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein automated matches [190211] (7 species) not a true protein |
Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225820] (18 PDB entries) |
Domain d4pwda1: 4pwd A:1-429 [263579] Other proteins in same PDB: d4pwda2, d4pwda3, d4pwdb_, d4pwdc2, d4pwdc3, d4pwdd_ automated match to d2ykna1 protein/DNA complex; protein/RNA complex; complexed with ca, nvp, so4 |
PDB Entry: 4pwd (more details), 3 Å
SCOPe Domain Sequences for d4pwda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pwda1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]} pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp plvklwyql
Timeline for d4pwda1: