Lineage for d4pwda1 (4pwd A:1-429)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622423Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 2622902Protein automated matches [190211] (7 species)
    not a true protein
  7. 2622933Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225820] (18 PDB entries)
  8. 2622952Domain d4pwda1: 4pwd A:1-429 [263579]
    Other proteins in same PDB: d4pwda2, d4pwda3, d4pwdb_, d4pwdc2, d4pwdc3, d4pwdd_
    automated match to d2ykna1
    protein/DNA complex; protein/RNA complex; complexed with ca, nvp, so4

Details for d4pwda1

PDB Entry: 4pwd (more details), 3 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase in complex with bulge-RNA/DNA and Nevirapine
PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4pwda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pwda1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d4pwda1:

Click to download the PDB-style file with coordinates for d4pwda1.
(The format of our PDB-style files is described here.)

Timeline for d4pwda1: