Lineage for d4pjxf1 (4pjx F:3-116)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366614Domain d4pjxf1: 4pjx F:3-116 [263540]
    Other proteins in same PDB: d4pjxa1, d4pjxa3, d4pjxb1, d4pjxb2, d4pjxc1, d4pjxc2, d4pjxd_, d4pjxe2, d4pjxf2, d4pjxg2, d4pjxh2
    automated match to d3of6c1
    complexed with 30w, b3p, cl, gol

Details for d4pjxf1

PDB Entry: 4pjx (more details), 2.25 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-a11 tcr
PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pjxf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjxf1 b.1.1.0 (F:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcassaaveggntiyfgegsrltvled

SCOPe Domain Coordinates for d4pjxf1:

Click to download the PDB-style file with coordinates for d4pjxf1.
(The format of our PDB-style files is described here.)

Timeline for d4pjxf1: