SCOPe 2.07: Domain d4pjxc1: 4pjx C:1-178

Lineage for d4pjxc1 (4pjx C:1-178)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)

8. Domain d4pjxc1: 4pjx C:1-178 [263539]
   Other proteins in same PDB: d4pjxa2, d4pjxa3, d4pjxb1, d4pjxb2, d4pjxc2, d4pjxd_, d4pjxe1, d4pjxe2, d4pjxf1, d4pjxf2, d4pjxg1, d4pjxg2, d4pjxh1, d4pjxh2
   automated match to d4l4vc1
   complexed with 30w, b3p, cl, gol

Details for d4pjxc1

PDB Entry: 4pjx, 2.25 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-a11 tcr

PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjxc1:

Sequence; same for both SEQRES and ATOM records:

>d4pjxc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d4pjxc1:

• d4pjxc1 first appeared in SCOPe 2.05
  
• d4pjxc1 appears in SCOPe 2.06
  
• d4pjxc1 appears in the current release, SCOPe 2.08