SCOPe 2.07: Domain d4pdcd_: 4pdc D:

Lineage for d4pdcd_ (4pdc D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries)

8. Domain d4pdcd_: 4pdc D: [263470]
   automated match to d1hyrb_

Details for d4pdcd_

PDB Entry: 4pdc, 1.99 Å

PDB Description: crystal structure of cowpox virus cpxv018 (omcp) bound to human nkg2d

PDB Compounds: (D:) nkg2-d type II integral membrane protein

SCOPe Domain Sequences for d4pdcd_:

Sequence; same for both SEQRES and ATOM records:

>d4pdcd_ d.169.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
qrt

Timeline for d4pdcd_:

• d4pdcd_ first appeared in SCOPe 2.05
  
• d4pdcd_ appears in SCOPe 2.06
  
• d4pdcd_ appears in the current release, SCOPe 2.08