Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries) |
Domain d4pdcd_: 4pdc D: [263470] automated match to d1hyrb_ |
PDB Entry: 4pdc (more details), 1.99 Å
SCOPe Domain Sequences for d4pdcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pdcd_ d.169.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm qrt
Timeline for d4pdcd_: