PDB entry 4pdc

View 4pdc on RCSB PDB site
Description: Crystal structure of Cowpox virus CPXV018 (OMCP) bound to human NKG2D
Class: immune system/viral protein
Keywords: secreted viral protein, immune evasion, orthopoxvirus, MHC-like fold, NK cell receptor ligand, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, IMMUNE SYSTEM-VIRAL PROTEIN complex
Deposited on 2014-04-17, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nkg2-d type II integral membrane protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KLRK1, D12S2489E, NKG2D
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26718 (0-122)
  Domains in SCOPe 2.07: d4pdca_
• Chain 'B':
  Compound: nkg2-d type II integral membrane protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KLRK1, D12S2489E, NKG2D
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26718 (Start-122)
  Domains in SCOPe 2.07: d4pdcb_
• Chain 'C':
  Compound: nkg2-d type II integral membrane protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KLRK1, D12S2489E, NKG2D
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26718 (0-122)
  Domains in SCOPe 2.07: d4pdcc_
• Chain 'D':
  Compound: nkg2-d type II integral membrane protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KLRK1, D12S2489E, NKG2D
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26718 (0-122)
  Domains in SCOPe 2.07: d4pdcd_
• Chain 'E':
  Compound: CPXV018 protein
  Species: Cowpox virus [TaxId:10243]
  Gene: CPXV018 CDS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8QN43 (1-149)
    • expression tag (0)
    • engineered mutation (23)
    • engineered mutation (95)
• Chain 'F':
  Compound: CPXV018 protein
  Species: Cowpox virus [TaxId:10243]
  Gene: CPXV018 CDS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8QN43 (1-149)
    • expression tag (0)
    • engineered mutation (23)
    • engineered mutation (95)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4pdcA (A:)
  esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
  hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
  qrt
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4pdcB (B:)
  esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
  hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
  qrt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4pdcB (B:)
  sycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksyh
  wmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicmq
  rt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4pdcC (C:)
  esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
  hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
  qrt
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4pdcD (D:)
  esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
  hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
  qrt
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.