Lineage for d1hyrb_ (1hyr B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607559Protein NK cell-activating receptor nkg2d [64453] (2 species)
  7. 2607560Species Human (Homo sapiens) [TaxId:9606] [64455] (4 PDB entries)
  8. 2607564Domain d1hyrb_: 1hyr B: [61414]
    Other proteins in same PDB: d1hyrc1, d1hyrc2

Details for d1hyrb_

PDB Entry: 1hyr (more details), 2.7 Å

PDB Description: crystal structure of human mica in complex with natural killer cell receptor nkg2d
PDB Compounds: (B:) nkg2-d type II integral membrane protein

SCOPe Domain Sequences for d1hyrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyrb_ d.169.1.1 (B:) NK cell-activating receptor nkg2d {Human (Homo sapiens) [TaxId: 9606]}
ipltesycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllkl
vksyhwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpnt
yicmqrtv

SCOPe Domain Coordinates for d1hyrb_:

Click to download the PDB-style file with coordinates for d1hyrb_.
(The format of our PDB-style files is described here.)

Timeline for d1hyrb_: