SCOPe 2.08: Domain d4p5og1: 4p5o G:2-183

Lineage for d4p5og1 (4p5o G:2-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), E2 M [TaxId:9606] [143058] (3 PDB entries)
   Uniprot P61081 27-183
   the extra N-terminal peptide, bound to the heterodimeric E1 enzyme for NEDD8, can be seen in the PDB entry 1tt5, chains E and F

8. Domain d4p5og1: 4p5o G:2-183 [263439]
   Other proteins in same PDB: d4p5oa1, d4p5oa2, d4p5ob_, d4p5oc1, d4p5oc2, d4p5od_, d4p5og2, d4p5og3, d4p5oh_, d4p5oi2, d4p5oi3, d4p5ok_
   automated match to d4p5oi_
   complexed with zn

Details for d4p5og1

PDB Entry: 4p5o, 3.11 Å

PDB Description: structure of an rbx1-ubc12~nedd8-cul1-dcn1 complex: a ring-e3- e2~ubiquitin-like protein-substrate intermediate trapped in action

PDB Compounds: (G:) NEDD8-conjugating enzyme Ubc12

SCOPe Domain Sequences for d4p5og1:

Sequence, based on SEQRES records:

>d4p5og1 d.20.1.1 (G:2-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]}
iklfslkqqkkeeesaggtkgsskkasaaqlriqkdinelnlpktcdisfsdpddllnfk
lvicpdegfyksgkfvfsfkvgqgyphdppkvkcetmvyhpsidlegnvslnilredwkp
vltinsiiyglqylflepnpedplnkeaaevlqnnrrlfeqnvqrsmrggyigstyferc
lk

Sequence, based on observed residues (ATOM records):

>d4p5og1 d.20.1.1 (G:2-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]}
iklfslkqqkkeeeaaqlriqkdinelnlpktcdisfsdpddllnfklvicpdegfyksg
kfvfsfkvgqgyphdppkvkcetmvyhpsidlegnvslnilredwkpvltinsiiyglqy
lflepnpedplnkeaaevlqnnrrlfeqnvqrsmrggyigstyferclk

Timeline for d4p5og1:

• d4p5og1 first appeared in SCOPe 2.05, called d4p5og_
  
• d4p5og1 appears in SCOPe 2.07