Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Human (Homo sapiens), E2 M [TaxId:9606] [143058] (3 PDB entries) Uniprot P61081 27-183 the extra N-terminal peptide, bound to the heterodimeric E1 enzyme for NEDD8, can be seen in the PDB entry 1tt5, chains E and F |
Domain d4p5og1: 4p5o G:2-183 [263439] Other proteins in same PDB: d4p5oa1, d4p5oa2, d4p5ob_, d4p5oc1, d4p5oc2, d4p5od_, d4p5og2, d4p5og3, d4p5oh_, d4p5oi2, d4p5oi3, d4p5ok_ automated match to d4p5oi_ complexed with zn |
PDB Entry: 4p5o (more details), 3.11 Å
SCOPe Domain Sequences for d4p5og1:
Sequence, based on SEQRES records: (download)
>d4p5og1 d.20.1.1 (G:2-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} iklfslkqqkkeeesaggtkgsskkasaaqlriqkdinelnlpktcdisfsdpddllnfk lvicpdegfyksgkfvfsfkvgqgyphdppkvkcetmvyhpsidlegnvslnilredwkp vltinsiiyglqylflepnpedplnkeaaevlqnnrrlfeqnvqrsmrggyigstyferc lk
>d4p5og1 d.20.1.1 (G:2-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} iklfslkqqkkeeeaaqlriqkdinelnlpktcdisfsdpddllnfklvicpdegfyksg kfvfsfkvgqgyphdppkvkcetmvyhpsidlegnvslnilredwkpvltinsiiyglqy lflepnpedplnkeaaevlqnnrrlfeqnvqrsmrggyigstyferclk
Timeline for d4p5og1: