SCOPe 2.07: Domain d4odxy_: 4odx Y:

Lineage for d4odxy_ (4odx Y:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
   beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing

4. Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families)

5. Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins)
   automatically mapped to Pfam PF00359

6. Protein automated matches [191189] (2 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [189471] (2 PDB entries)

8. Domain d4odxy_: 4odx Y: [263281]
   Other proteins in same PDB: d4odxa_, d4odxb_, d4odxh_, d4odxl_
   automated match to d3lf6b_

Details for d4odxy_

PDB Entry: 4odx, 3.1 Å

PDB Description: 4E10 germline encoded precursor no.7 in complex with epitope scaffold T117

PDB Compounds: (Y:) 4E10 epitope scaffold T117

SCOPe Domain Sequences for d4odxy_:

Sequence; same for both SEQRES and ATOM records:

>d4odxy_ d.112.1.1 (Y:) automated matches {Artificial gene [TaxId: 32630]}
amqgihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpve
pvgvaiphtdskyvrqnaisvgilaepvnfedaggepdpvpvrvvfmlalgnwfditnvl
wwimdviqdedfmqqllvmnddeiyqsiytris

Timeline for d4odxy_:

• d4odxy_ first appeared in SCOPe 2.05
  
• d4odxy_ appears in SCOPe 2.06
  
• d4odxy_ appears in the current release, SCOPe 2.08