Lineage for d4odxl_ (4odx L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369634Domain d4odxl_: 4odx L: [260203]
    Other proteins in same PDB: d4odxx_, d4odxy_
    automated match to d4llvb_

Details for d4odxl_

PDB Entry: 4odx (more details), 3.1 Å

PDB Description: 4E10 germline encoded precursor no.7 in complex with epitope scaffold T117
PDB Compounds: (L:) GEP7 Fv light chain

SCOPe Domain Sequences for d4odxl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4odxl_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspstfgqgtkveikr

SCOPe Domain Coordinates for d4odxl_:

Click to download the PDB-style file with coordinates for d4odxl_.
(The format of our PDB-style files is described here.)

Timeline for d4odxl_: