SCOPe 2.06: Domain d4odxl_: 4odx L:

Lineage for d4odxl_ (4odx L:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4odxl_: 4odx L: [260203]
   Other proteins in same PDB: d4odxx_, d4odxy_
   automated match to d4llvb_

Details for d4odxl_

PDB Entry: 4odx, 3.1 Å

PDB Description: 4E10 germline encoded precursor no.7 in complex with epitope scaffold T117

PDB Compounds: (L:) GEP7 Fv light chain

SCOPe Domain Sequences for d4odxl_:

Sequence; same for both SEQRES and ATOM records:

>d4odxl_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspstfgqgtkveikr

Timeline for d4odxl_:

• d4odxl_ first appeared in SCOPe 2.04
  
• d4odxl_ appears in SCOPe 2.05
  
• d4odxl_ appears in SCOPe 2.07
  
• d4odxl_ appears in the current release, SCOPe 2.08