Lineage for d3lf6b_ (3lf6 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossingSuperfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) 
Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins)
automatically mapped to Pfam PF00359
Protein automated matches [191189] (1 species)
not a true proteinSpecies Artificial gene [TaxId:32630] [189471] (2 PDB entries) 
Domain d3lf6b_: 3lf6 B: [180245]
automated match to d1xiza_
complexed with po4
Details for d3lf6b_
PDB Entry: 3lf6 (more details), 1.9 Å
PDB Description: Crystal structure of HIV epitope-scaffold 4E10_1XIZA_S0_001_N
PDB Compounds: (B:) Putative phosphotransferase systemSCOPe Domain Sequences for d3lf6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lf6b_ d.112.1.1 (B:) automated matches {Artificial gene [TaxId: 32630]}
hhhnamqgihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptg
lpvepvgvaiphtdskyvrqnaisvgilaepvnfedaggepdpvpvrvvfmlalgnwfdi
tnvlwwimdviqdedfmqqllvmnddeiyqsiytris
SCOPe Domain Coordinates for d3lf6b_:
Click to download the PDB-style file with coordinates for d3lf6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lf6b_:
- d3lf6b_ first appeared in SCOPe 2.01
- d3lf6b_ appears in SCOPe 2.04
- d3lf6b_ is called d3lf6b1 in SCOPe 2.06
- d3lf6b_ appears in the current release, SCOPe 2.08, called d3lf6b1
View in 3D
