| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily) beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing |
Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) ![]() |
| Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins) automatically mapped to Pfam PF00359 |
| Protein automated matches [191189] (1 species) not a true protein |
| Species Artificial gene [TaxId:32630] [189471] (2 PDB entries) |
| Domain d3lf6b1: 3lf6 B:7-160 [180245] Other proteins in same PDB: d3lf6b2 automated match to d1xiza_ complexed with po4 |
PDB Entry: 3lf6 (more details), 1.9 Å
SCOPe Domain Sequences for d3lf6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lf6b1 d.112.1.1 (B:7-160) automated matches {Artificial gene [TaxId: 32630]}
namqgihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpv
epvgvaiphtdskyvrqnaisvgilaepvnfedaggepdpvpvrvvfmlalgnwfditnv
lwwimdviqdedfmqqllvmnddeiyqsiytris
Timeline for d3lf6b1: