SCOPe 2.06: Domain d3lf6b1: 3lf6 B:7-160

Lineage for d3lf6b1 (3lf6 B:7-160)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
   beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing

4. Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families)

5. Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins)
   automatically mapped to Pfam PF00359

6. Protein automated matches [191189] (1 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [189471] (2 PDB entries)

8. Domain d3lf6b1: 3lf6 B:7-160 [180245]
   Other proteins in same PDB: d3lf6b2
   automated match to d1xiza_
   complexed with po4

Details for d3lf6b1

PDB Entry: 3lf6, 1.9 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10_1XIZA_S0_001_N

PDB Compounds: (B:) Putative phosphotransferase system

SCOPe Domain Sequences for d3lf6b1:

Sequence; same for both SEQRES and ATOM records:

>d3lf6b1 d.112.1.1 (B:7-160) automated matches {Artificial gene [TaxId: 32630]}
namqgihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpv
epvgvaiphtdskyvrqnaisvgilaepvnfedaggepdpvpvrvvfmlalgnwfditnv
lwwimdviqdedfmqqllvmnddeiyqsiytris

Timeline for d3lf6b1:

• d3lf6b1 first appeared in SCOPe 2.01, called d3lf6b_
  
• d3lf6b1 was called d3lf6b_ in SCOPe 2.05
  
• d3lf6b1 appears in SCOPe 2.07
  
• d3lf6b1 appears in the current release, SCOPe 2.08